LL-37 is a peptide research compound which is being studied in the fields of molecular biology, peptide chemistry, and antimicrobial peptide research. LL-37 is researched as a model peptide to learn about peptide structure, molecular interactions, signaling pathways of cellular communication, and mechanisms of biological signaling under laboratory conditions.
LL-37
$149.99
Size / Strength
Every batch of LL-37 is independently third-party tested. 30-day money-back guarantee — no questions asked.
Product Description
LL-37 is one of the types of naturally occurring biomolecules called antimicrobial peptides (AMPs) that are heavily researched in science because of their unique molecular properties and interactions with biological systems.
Research conducted on LL-37 involves the study of peptide properties, biochemical mechanisms, and molecular pathways but not their approved medical uses.
LL-37 10mg supplied by Peptides Australia is a Research Use Only (RUO) laboratory material which is used only for scientific and analytical research purposes. Every batch of the product is accompanied by quality documentation such as analytical test results and Certificates of Analysis (COA) to help assess laboratory materials with transparency.
Research Highlights
- Independent Laboratory Tested
- Batch-Specific Certificate of Analysis
- Australia-Wide Dispatch
- Research Use Only
- HPLC Tested Peptide Material
What is LL-37?
LL-37 is a man-made peptide research chemical that is examined in relation to the study of antimicrobial peptide science and molecular science.
This peptide is synthesized in the human cathelicidin antimicrobial peptide group and serves as a vital model in peptide research.
Examinations of LL-37 are performed to learn more about:
- Peptide molecular structure
- Interactions between peptide and membrane
- Cell signaling pathways
- Communication of molecules
As a research peptide, LL-37 is examined in laboratory settings.
Scientific Background of LL-37 Research
The study of peptides is significant in biotechnology, molecular biology, and analytical chemistry. Scientists conduct research on peptides due to the impact that the amino acid sequence has on:
- Three-dimensional structure
- Chemical characteristics
- Stability characteristics
- Molecular interactions
Peptide models permit scientists to study certain characteristics of molecules in controlled experiments in laboratories.
LL-37 is a specialized peptide model studied in antimicrobial peptide research.
Antimicrobial Peptide (AMP) Research Background
Antimicrobial peptides (AMPs) are a large family of naturally occurring molecules which have been extensively studied in molecular biology.
Scientists study AMPs for:
- Structure of peptides
- Molecular interactions
- Biological signaling
- Membrane associated functions
LL-37 is among the most studied peptides from the human derived family in AMP research.
Studies conducted on LL-37 focus on molecular properties and interactions and not treatment purposes.
Classification of Peptides
LL-37 belongs to the class of synthetic AMP research peptides.
Peptides consist of small chain amino acids linked by peptide bonds.
The characteristics of peptides depend on:
- Amino acid sequence
- Molecular structure
- Chemical environment
- Peptide modifications
Scientists conduct analysis of peptides using chromatography and mass spectrometry techniques in laboratories.
Molecular Characteristics of LL-37
Understanding molecular properties is an essential part of peptide research.
LL-37 has a defined amino acid sequence that researchers evaluate through analytical methods.
Product Specification Table
Peptide Structure and Composition
LL-37 has a known amino acid sequence that is investigated by scientists to study the connection between molecular structure and biology.
Possible laboratory studies may include:
- Sequence of peptides
- Chemical properties
- Stability of molecules
- Interaction modes
Structural investigations enable scientists to learn how the structure of peptides affects their behavior in laboratories.
Lyophilized Powder Form
LL-37 is presented as a lyophilized powder that is used for laboratory studies. Lyophilization is the process of freeze drying that is often applied to peptides. This process lowers the water content and helps achieve consistency in storage and transportation.
Advantages of lyophilized research peptides are:
- Low water content
- Consistency in storage
- Ease of documentation
- Controlled handling
Scientists must apply laboratory rules when working with lyophilized peptide substances.
Stability Considerations
Peptide stability is affected by numerous environmental factors.
Scientists generally account for:
- Temperature exposure
- Moisture content
- Light exposure
- Package conditions
- Duration of storage
Appropriate storage environments aid in the preservation of research material properties.
Researchers can refer to the following information sources on this topic:
- Peptide Purity Understanding
- Peptide Storage Tips
- Guide to Reading a Certificate of Analysis
Why Researchers Study LL-37
Scientific interest in LL-37 is connected with its functioning as a popular peptide model in molecular biology studies.
Laboratory studies concentrate on the understanding of:
- Structure of peptide
- Molecular interactions
- Communication between cells
- Biological signal pathways
Such studies make their contribution into the scientific understanding of peptide chemistry and molecular systems.
Innate Immunity Research Context
Innate immunity is a subject of intense scientific research and study in relation to molecular communication networks. Scientists research innate immunity signal pathways in order to learn about:
- Cellular signaling
- Processes of molecular recognition
- Peptide interactions
- Mechanisms of biological response
LL-37 is researched as a peptide model in this scientific field.
Such studies are performed for the purpose of understanding molecular processes and not approved medical treatment.
Peptide–Membrane Interaction Studies
Researchers analyze the interaction between structures of peptides and biological membranes.
Laboratory experiments can examine:
- Peptide structure
- Surface interaction
- Molecular organization
- Chemical properties
LL-37 allows scientists to have a clear model of a peptide for studying interactions with the membrane.
Inflammatory Pathway Research Models
Studies in cellular signalling explore how molecules are communicated in biological systems.
Scientists explore:
- Signal pathways
- Interactions of molecules
- Methods of cellular communication
- Biochemical reactions
LL-37 studies help to expand knowledge in signaling peptide-based systems.
Experimental Laboratory Applications
Inflammatory pathways are complex biological systems studied in molecular biology.
Researchers study these pathways to understand:
- Cellular communication
- Molecular regulation
- Peptide interactions
- Processes of biological signaling
LL-37 is researched as a peptide model in this field of research.
Experimental Laboratory Applications
LL-37 can be studied through laboratory experiments such as:
- Analytical chemistry
- Molecular characterization
- Peptide interactions
- Biochemical study
The goal of these studies is to extend knowledge about peptide structure and molecular biology.
Manufacturing & Quality Standards
Reliable research peptides require proper synthesis procedures, analysis and documentation.
LL-37 10mg is synthesized as a peptide research product through the use of well-known peptide chemistry processes which help to provide consistency, traceability and analysis in laboratories.
Manufacturing of quality focused peptide products generally involves the following steps:
- Peptide sequence preparation
- Synthesis
- Purification
- Testing
- Lyophilisation
- Batch documentation
This way, researchers will have the opportunity to analyze laboratory peptide products by means of quality information.
Solid Phase Peptide Synthesis (SPPS)
Solid Phase Peptide Synthesis (SPPS) is one of the processes that are usually used in the production of synthetic peptides and it has been widely used in peptide chemistry and biotechnology. It provides a controlled assembly of amino acids in a defined peptide structure. The general manufacturing process involves the following steps:
- Choice of the peptide sequence
- Amino acids coupling reactions
- De-protection of the synthesis support
- Purification of the peptide
- Testing
- Lyophilisation process
- Batch documentation
In this way, it is possible to manufacture research peptide materials with defined molecular properties.
Purification Process
Once the synthesis process is completed, purification is done to isolate the desired peptide from other contaminants. The purification process assists in the removal of:
- Incomplete peptide chains
- Unwanted synthesis materials
- Related peptides
- Impurities caused by the process
A consistent purification process ensures reliable and analytical results and effective research documentation.
Lyophilisation Process
Once the peptide is purified and analyzed, LL-37 is lyophilised into a powder. The lyophilisation process is a freeze-dry process and is commonly used to lyophilize research peptides. The process assists in reducing the water content in the peptide while maintaining consistency during transportation and storage. Benefits of lyophilized research peptides include:
- Reduction in moisture content
- Consistency during storage
- Ease of laboratory documentation
- Consistent material handling
Scientists should adhere to appropriate laboratory procedures for lyophilized peptide materials.
Research Use Only (RUO)
LL-37 10mg manufactured by Peptides Australia is offered strictly for Research Use Only (RUO) in the laboratory setting.
This product may be used for:
- Scientific research
- Laboratory testing
- Research work
- Experimental studies
LL-37 is not authorized in Australia for therapeutic, diagnostic, veterinary, cosmetic or human use.
Research Materials vs Approved Products
There are distinct differences between research peptides and approved products. Evaluation of approved pharmaceutical products includes:
- Safety assessment
- Clinical studies
- Manufacturing process
- Medical application approval
Research peptides are sold for scientific research purposes and are not approved medicines.
Responsible Research Laboratory
Researchers and institutions that receive RUO products are responsible for:
- Compliance with institutional requirements
- Laboratory safety procedures
- Laboratory research practices
- Appropriate Australian legislation
LL-37 should only be used in proper laboratory settings.
Why Choose Peptides Australia?
Reputable peptide research relies on the availability of clear documentation, accurate information and quality laboratory materials.
Peptides Australia assists researchers through the provision of information aimed at:
- Universities
- Biotechnology companies
- Research laboratories
- Scientific institutions
Batch-Specific Certificate of Analysis
Batch specific COAs offer analytical information specific to a product.
This is useful for:
- Laboratory documentation
- Material verification
- Research traceability
Independent Laboratory Testing
Testing offers researchers information about:
- Peptide identity
- Characteristics of peptide purity
HPLC Tested Peptides
HPLC testing offers analytical information about the purity and composition of the peptide.
Researchers can view testing documentation when assessing laboratory materials.
Packaging Protection
Proper packaging ensures the safety of lyophilized research materials during transportation and storage.
Australia-Wide Dispatch
Quality dispatch facilitates access for:
- Research institutions
- Universities
- Biotechnology companies
- Scientific laboratories
Researchers looking to purchase LL-37 in Australia should consider the product specifications, the availability of Certificate of Analysis, testing information and Research Use Only categorization.
This product is intended solely for laboratory research purposes. Not for human consumption.
Storage & Handling
Storage & Laboratory Handling Guidelines
Proper storage and handling methods are crucial for the maintenance of quality of research peptides. LL-37 is delivered as a lyophilized powder and requires proper handling following laboratory procedures.
Temperature Considerations
Researchers need to account for temperature-controlled storage that does not allow any unnecessary temperature fluctuations. Key factors include:
- Compliance with recommended storage conditions
- Prevention of unnecessary temperature fluctuations
- Protection of material during transport
Moisture Protection
Peptide materials in the form of lyophilized powders require protection against moisture contact. Recommended laboratory practices include:
- Sealing of containers properly
- Minimization of humidity contact
- Following manufacturer recommendations for storage
Light Protection
Researchers need to account for protection of peptides from prolonged direct light exposure. Temperature-controlled storage contributes to preservation of material properties.
Laboratory Documentation
It is common practice for laboratories to have records with information pertaining to:
- Batches
- Storage conditions
- Specifications
- Procedures
Proper documentation will help to ensure responsible laboratory quality systems.
There are options to investigate:
- Guidelines on How to Store Peptides
- Guide to Reading the Certificate of Analysis
- Laboratory Quality Control
Full Technical Specifications
Every batch of LL-37 is independently analysed before dispatch. The values below describe the current research batch.
| Product Name | LL-37 |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | 4493.3 g/mol |
| Quantity / Strength | 10mg |
| Purity | ≥ 99% (HPLC) |
| Form | Lyophilised Powder |
| Appearance | White Lyophilised Powder |
| Sequence | [LL-37, 37 aa] |
| Batch Number | PA-0123 |
| Storage Conditions | 2°C-8°C (Refrigerated) |
| Category | Healing & Recovery |
| Intended Use | Research Use Only — not for human consumption |
Certificate of Analysis
Every batch of LL-37 is independently tested before dispatch. View the full COA for the current batch below.
Certificate of Analysis (COA)
Batch Number PA-0123
| COA Information | Purpose |
|---|---|
| Product Name | Confirms peptide identification |
| Batch Number | Supports traceability |
| Purity Results | Provides analytical evaluation |
| Testing Method | Identifies laboratory techniques |
| Identity Testing | Supports molecular confirmation |
| Quality Review | Documents assessment |
Batch Traceability and Quality Documentation
Batch traceability is a vital aspect of research peptide provision. Documents involved with LL-37 can include:
- Product name
- Batch number
- Analysis data
- Quality specifications
- Storage conditions
Maintaining proper documentation assists universities, biotechnology firms, and research institutions in documenting laboratory materials.
Purity Testing & Certificate of Analysis (COA)
Analytical testing offers researchers information on peptide identity, purity attributes, and quality specifications.
Prior to choosing laboratory peptides, researchers typically consider the following aspects:
- Purity information
- Analytical testing results
- Peptide identification
- Batch information
High-Performance Liquid Chromatography (HPLC)
One of the most frequently applied analytical tests in assessing peptide purity is High-Performance Liquid Chromatography (HPLC). This analytical technique involves separating compounds within a sample and creating a chromatographic profile. With respect to research materials of LL-37, HPLC testing may reveal information on:
- Percentage of purity
- Components of the sample
- Associated substances
- Consistency of batch
HPLC testing is frequently used within peptide chemistry, biotechnology, and academic laboratories.
Researchers interested in analytical techniques may learn about:
- Understanding Peptide Purity
- HPLC vs LC-MS Testing
- Third Party Laboratory Testing
LC-MS Identity Testing
Liquid Chromatography–Mass Spectrometry (LC-MS) is often employed in identity testing of peptides. LC-MS testing enables researchers to assess:
- Molecular weight
- Peptide identity
- Structure properties
The use of complementary analytical techniques offers more comprehensive information about research peptides.
Certificate of Analysis Explained
A Certificate of Analysis (COA) is a batch-specific quality document containing analytical information about a research peptide.
A typical COA may include:
A COA provides an opportunity for researchers to evaluate laboratory material specifications prior to starting scientific investigations.
Researchers evaluating options to purchase LL-37 in Australia need to analyze Certificate of Analysis, analytical testing data and supplier quality standards prior to choosing research peptides.
Research Disclaimer
This content is provided for educational, scientific and research-information purposes only. It does not provide medical advice, treatment recommendations or personal dosage instructions. Available evidence concerning LL-37 includes preclinical research and limited clinical investigations. Further research is required to better understand its safety, pharmacology and potential efficacy for specific research applications.
- Not for human or veterinary use
- No claims are made regarding safety or efficacy in humans
- Must be handled with appropriate laboratory safety equipment
- Purchaser assumes all responsibility for legal, compliant use
References
5 sources- 1Dürr UHN, Sudheendra US, Ramamoorthy A. LL-37, the Only Human Member of the Cathelicidin Family of Antimicrobial Peptides. Biochimica et Biophysica Acta (BBA) - Biomembranes. 2006;1758(9):1408-1425.PubMed: https://pubmed.ncbi.nlm.nih.gov/16716248/
- 2Duplantier AJ, van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Frontiers in Immunology. 2013;4:143. PubMed: https://pubmed.ncbi.nlm.nih.gov/23840194/PubMed: https://pubmed.ncbi.nlm.nih.gov/23840194/
- 3Grönberg A, Mahlapuu M, Ståhle M, Whately-Smith C, Rollman O. Treatment with LL-37 Is Safe and Effective in Enhancing Healing of Hard-to-Heal Venous Leg Ulcers: A Randomized, Placebo-Controlled Clinical Trial. Wound Repair and Regeneration. 2014;22(5):613-621.PubMed: https://pubmed.ncbi.nlm.nih.gov/25041740/
- 4Kahlenberg JM, Kaplan MJ. Little Peptide, Big Effects: The Role of LL-37 in Inflammation and Autoimmune Disease. Journal of Immunology. 2013;191(10):4895-4901.PubMed Central: https://pmc.ncbi.nlm.nih.gov/articles/PMC3836506/
- 5Australian Government, Therapeutic Goods Administration (TGA). Concerns Regarding the Public Health Risks Associated with Unapproved Peptide Products. Therapeutic Goods Administration. 2026.TGA: https://www.tga.gov.au/news/media-releases/concerns-regarding-public-health-risks-associated-unapproved-peptide-products
Citations are provided for research reference and open in a new tab. Listing a study does not imply it evaluated this specific product.
Frequently Asked Questions
Why Researchers Choose Us






